General Information

  • ID:  hor005411
  • Uniprot ID:  P01336
  • Protein name:  Insulin B chain
  • Gene name:  ins
  • Organism:  Gadus morhua subsp. callarias (Baltic cod) (Gadus callarias)
  • Family:  insulin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Gadus morhua (species), Gadus (genus), Gadidae (family), Gadoidei (suborder), Gadiformes (order), Gadariae, Zeiogadaria, Paracanthopterygii, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0005975 carbohydrate metabolic process; GO:0006006 glucose metabolic process; GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  MAPPQHLCGSHLVDALYLVCGDRGFFYNPK
  • Length:  30
  • Propeptide:  MAPPQHLCGSHLVDALYLVCGDRGFFYNPKGIVDQCCHRPCDIFDLQNYCN
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01336-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005411_AF2.pdbhor005411_ESM.pdb

Physical Information

Mass: 386736 Formula: C152H226N40O40S3
Absent amino acids: EITW Common amino acids: L
pI: 7.41 Basic residues: 4
Polar residues: 9 Hydrophobic residues: 10
Hydrophobicity: 5 Boman Index: -1802
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 78
Instability Index: 3259.33 Extinction Coefficient cystines: 3105
Absorbance 280nm: 107.07

Literature

  • PubMed ID:  4881974
  • Title:  The sequence of amino acids in insulin isolated from islet tissue of the cod (Gadus callarias).
  • PubMed ID:  4866431
  • Title:  Isolation and a partial amino acid sequence of insulin from the islet tissue of cod (Gadus callarias).